Proteinvariations




Enter Protein ID (e.g. P02662 for bovine beta-casein) :

Enter Genetic variant ID (e.g. "A1" for genetic variant A1) :

Enter Protein name :

Enter Organism :

Enter Sequence :

Enter Signal Peptide ( e.g. "1-15") :

Enter Known potential PTMs ( e.g. 22 Phosphoserine;107 Phosphoserine) :

Enter Glycosylation( e.g. "1-15") :



Protein IDVariationProtein NameOrganismSequenceSignal PeptideKnown potential PTMsGlycosylations
P00711ALALBA_BOVIN genetic variant A (Rather common)Bos taurus, Bos indicusMMSFVSLLLVGILFHATQAEQLTKCEVFQELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFL
DDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
1 1964 N-linked (GlcNAc...) asparagine
P00711B (REF)LALBA_BOVIN genetic variant B (Most common)Bos taurus, Bos indicus, Bos grunniensMMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFL
DDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
1 1964 N-linked (GlcNAc...) asparagine
P02662ICASA1_BOVIN genetic variant I (Rather common)Bos taurus, Bos indicusMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKDD
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
IGSENSEKTTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662HCASA1_BOVIN genetic variant H (Rare)Bos taurusMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLG
YLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEK
TTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662GCASA1_BOVIN genetic variant G (Rather common)Bos taurusMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKED
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
IGSENSEKTTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662FCASA1_BOVIN genetic variant F (Rare)Bos taurusMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESILSSEEIVPNSVEQKHIQKED
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
IGSENSEKTTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662ECASA1_BOVIN genetic variant E (common)Bos grunniensMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKKMEAESISSSEEIVPNSVEQKHIQKED
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
IGSENSGKTTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662DCASA1_BOVIN genetic variant D (Rather common)Bos taurusMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQTMEDIKQMEAESISSSEEIVPNSVEQKHIQKED
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
IGSENSEKTTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
68 phosphothreoine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662CCASA1_BOVIN genetic variant C (Common)Bos taurus, Bos indicus, Bos grunniens, Bos JavanicusMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKED
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
IGSENSGKTTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662B (REF)CASA1_BOVIN genetic variant B (Most common)Bos taurus, Bos indicus, Bos grunniensMKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKED
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
IGSENSEKTTMPLW
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02662ACASA1_BOVIN genetic variant A (Rather common)Bos taurusMKLLILTCLVAVALARPKHPIKHQGLPQPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQL
LRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEKTTMPL
W
1 1556 Phosphoserine
61 Phosphoserine
63 Phosphoserine
79 Phosphoserine
81 Phosphoserine
82 Phosphoserine
83 Phosphoserine
90 Phosphoserine
130 Phosphoserine
P02663A (REF)CASA2_BOVIN genetic variant A (Most common)Bos taurus, Bos indicus, Bos grunniens, Bos JavanicusMKFFIFTCLLAVALAKNTMEHVSSSEESIISQETYKQEKNMAINPSKENLCSTFCKEVVRNANEEEYSIGSSSEESAEVATEEVKITVDDKHYQKALNEI
NQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSTSEENSKKTVDMESTEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQ
HQKAMKPWIQPKTKVIPYVRYL
1 1523 Phosphoserine
24 Phosphoserine
25 Phosphoserine
28 Phosphoserine
46 Phosphoserine
71 Phosphoserine
72 Phosphoserine
73 Phosphoserine
76 Phosphoserine
144 Phosphoserine
146 Phosphoserine
150 Phosphoserine
158 Phosphoserine
P02663BCASA2_BOVIN genetic variant B (Common)Bos taurus, Bos indicus, Bos grunniensMKFFIFTCLLAVALAKNTMEHVFSSEESIISQETYKQEKNMAINPSKENLCSTFCKEVVRNANEEEYSIGSSSEESAEVATEEVKITVDDKHYQKALNEI
NQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSTSEENSKKTVDMESTEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQ
HQKAMKPWIQPKTKVIPYVRYL
1 1523 Phosphoserine
24 Phosphoserine
25 Phosphoserine
28 Phosphoserine
46 Phosphoserine
71 Phosphoserine
72 Phosphoserine
73 Phosphoserine
76 Phosphoserine
144 Phosphoserine
146 Phosphoserine
150 Phosphoserine
158 Phosphoserine
P02663CCASA2_BOVIN genetic variant C (Rare)Bos grunniensMKFFIFTCLLAVALAKNTMEHVSSSEESIISQETYKQEKNMAINPSKGNLCSTFCKEVVRNTNEEEYSIGSSSEESAEVATEEVKITVDDKHYQKALNEI
NQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSISEENSKKTVDMESTEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQ
HQKAMKPWIQPKTKVIPYVRYL
1 1523 Phosphoserine
24 Phosphoserine
25 Phosphoserine
28 Phosphoserine
46 Phosphoserine
71 Phosphoserine
72 Phosphoserine
73 Phosphoserine
76 Phosphoserine
144 Phosphoserine
146 Phosphoserine
150 Phosphoserine
158 Phosphoserine
P02663DCASA2_BOVIN genetic variant D (Rather common)Bos taurusMKFFIFTCLLAVALAKNTMEHVSSSEESIISQETYKQEKNMAINPSKENLCSTFCKEVVRNANEEESAEVATEEVKITVDDKHYQKALNEINQFYQKFPQ
YLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSTSEENSKKTVDMESTEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWI
QPKTKVIPYVRYL
1 1523 Phosphoserine
24 Phosphoserine
25 Phosphoserine
28 Phosphoserine
46 Phosphoserine
71 Phosphoserine
72 Phosphoserine
73 Phosphoserine
76 Phosphoserine
144 Phosphoserine
146 Phosphoserine
150 Phosphoserine
158 Phosphoserine
P02666DCASB_BOVIN genetic variant D (Rare)Bos indicusMKVLILACLVALALARELEELNVPGEIVESLSKSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666ECASB_BOVIN genetic variant E (Rare)Bos taurusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSKEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666H1CASB_BOVIN genetic variant H1 (Rare)Bos taurusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVP
PFLQPEVLGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666GCASB_BOVIN genetic variant G (Rare)Bos taurusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIHNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLLLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666ICASB_BOVIN genetic variant I (Rather common)Bos taurusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVP
PFLQPEVLGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666FCASB_BOVIN genetic variant F (Rare)Bos taurusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIHNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLLPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666CCASB_BOVIN genetic variant C (Rather common)Bos taurusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEKQQQTEDELQDKIHPFAQTQSLVYPFPGPIHNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
P02666BCASB_BOVIN genetic variant B (Common)Bos taurus, Bos indicusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIHNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTERQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666A3CASB_BOVIN genetic variant A3 (Rather common)Bos taurus, Bos indicusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKQKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02666A2CASB_BOVIN genetic variant A2 (Most common)Bos taurus, Bos indicus, Bos grunniens, Bos JavanicusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 15MOD_RES 30 30 Phosphoserine. {ECO:0000269|PubMed:16083266, ECO:0000269|PubMed:17510049, ECO:0000269|PubMed:4557764}.
MOD_RES 32 32 Phosphoserine. {ECO:0000269|PubMed:16083266, ECO:0000269|PubMed:17510049, ECO:0000269|PubMed:4557764}.
MOD_RES 33 33 Phosphoserine. {ECO:0000269|PubMed:16083266, ECO:0000269|PubMed:17510049, ECO:0000269|PubMed:4557764}.
MOD_RES 34 34 Phosphoserine. {ECO:0000269|PubMed:16083266, ECO:0000269|PubMed:17510049, ECO:0000269|PubMed:4557764}.
MOD_RES 50 50 Phosphoserine
in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H. {ECO:0000269|PubMed:16083266, ECO:0000269|PubMed:17510049}.
P02666A1CASB_BOVIN genetic variant A1 (Common)Bos taurus, Bos indicusMKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIHNSLPQNIPPLTQTPVVVP
PFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDM
PIQAFLLYQEPVLGPVRGPFPIIV
1 1530 Phosphoserine
32 Phosphoserine
33 Phosphoserine
34 Phosphoserine
50 Phosphoserine (in variant A1, variant A2, variant A3, variant B, variant E, variant F, variant G and variant H)
P02668A (REF)CASK_BOVIN genetic variant A (Most common)Bos taurus, Bos indicusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668BCASK_BOVIN genetic variant B (Most common)Bos taurus, Bos indicusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine; 153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine; 157 O-linked (GalNAc...) threonine; 163 O-linked (GalNAc...) threonine; 170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668B2CASK_BOVIN genetic variant B2Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVTESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668CCASK_BOVIN genetic variant C (Rather common)Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMAHHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668DCASK_BOVIN genetic variant D (Rare)Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMAHHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668ECASK_BOVIN genetic variant E (Rather common)Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIEGPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668F1CASK_BOVIN genetic variant F1 (Rare)Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEVSPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668F2CASK_BOVIN genetic variant F2 (Rare)Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIHCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668G1CASK_BOVIN genetic variant G1 (Rare)Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMACHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPITEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668G2CASK_BOVIN genetic variant G2 (Common)Bos grunniensMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEASPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668HCASK_BOVIN genetic variant H (Common)Bos taurus, Bos indicusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPITEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668ICASK_BOVIN genetic variant I (Rare)Bos taurus, Bos indicusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLIFMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668JCASK_BOVIN genetic variant J (Rare)Bos taurusMMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVL
SNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVIERPPEINTVQVTSTAV
1 2122 Pyrrolidone carboxylic acid
148 Phosphoserine
166 Phosphothreonine
170 Phosphoserine
187 Phosphoserine
142 O-linked (GalNAc...) threonine;152 O-linked (GalNAc...) threonine;153 O-linked (GalNAc...) serine;154 O-linked (GalNAc...) threonine;157 O-linked (GalNAc...) threonine;163 O-linked (GalNAc...) threonine;170 O-linked (GalNAc...) serine;186 O-linked (GalNAc...) threonine partial
P02668CMP-ACaseinomacropeptide genetic variant ABos taurus, Bos indicusMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
P02668CMPCaseinomacropeptideBos taurus (Bovine)MAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
P02668CMP-BCaseinomacropeptide genetic variant BBos taurus, Bos indicusMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVIESPPEINTVQVTSTAV
P02668CMP-B2Caseinomacropeptide genetic variant B2Bos taurusMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVTESPPEINTVQVTSTAV
P02668CMP-CCaseinomacropeptide genetic variant CBos taurusMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVIESPPEINTVQVTSTAV
P02668CMP-ECaseinomacropeptide genetic variant EBos taurusMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIEGPPEINTVQVTSTAV
P02668CMP-F1Caseinomacropeptide genetic variant F1Bos taurusMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEVSPEVIESPPEINTVQVTSTAV
P02668CMP-F2Caseinomacropeptide genetic variant F2Bos taurusMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
P02668CMP-G1Caseinomacropeptide genetic variant G1Bos taurusMAIPPKKNQDKTEIPTINTIASGEPTSTPITEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
P02668CMP-G2Caseinomacropeptide genetic variant G2Bos grunniensMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEASPEVIESPPEINTVQVTSTAV
P02668CMP-HCaseinomacropeptide genetic variant HBos taurus, Bos indicusMAIPPKKNQDKTEIPTINTIASGEPTSTPITEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
P02668CMP-ICaseinomacropeptide genetic variant IBos taurus, Bos indicusMAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
P02668CMP-JCaseinomacropeptide genetic variant JBos taurusMAIPPKKNQDKTEIPTINTIASGEPTSTPTIEAVESTVATLEASPEVIERPPEINTVQVTSTAV
P02754ALACB_BOVIN genetic variant A (Most common)Bos taurus, Bos indicus, Bos grunniensMKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16
P02754B (REF)LACB_BOVIN genetic variant B (Most common)Bos taurus, Bos indicus, Bos grunniensMKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16
P02754CLACB_BOVIN genetic variant C (Rather common)Bos taurus MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLHKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16
P02754DLACB_BOVIN genetic variant D (Rather common)Bos taurus MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEQLKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16
P02754ELACB_BOVIN genetic variant E (Most common)Bos grunniens, Bos JavanicusMKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEGQCHI
1 16
P02754FLACB_BOVIN genetic variant F (Rare)Bos JavanicusMKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTSEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVYDEALEKFDKALKALPMHIRLSFNPTQLEGQCHI
1 16
P02754GLACB_BOVIN genetic variant G (Rare)Bos JavanicusMKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKMPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEGQCHI
1 16
P02754HLACB_BOVIN genetic variant H (Rare)Bos taurusMKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKNIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16
P02754ILACB_BOVIN genetic variant I (Rare)Bos taurus MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMGNSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16
P02754JLACB_BOVIN genetic variant J (Rare)Bos taurus MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTLEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16
P02754WLACB_BOVIN genetic variant W (Rare)Bos taurus MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLELLLQKWENGECAQKKIIAEKTKIPAVFKI
DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
1 16